Shopping Cart - CHF 0.00

You have no items in your shopping cart.

  • Home  » 
  • 4025809
Return to Previous Page
4025809

Availability: In stock

pTH (1-31) (human)
H-Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-OH

4025809

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
4025809.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 704.00
CHF 654.72 (7%)
4025809.1000 1 mg Ships within 3-5 business days  
CHF 1,261.00
CHF 1,172.73 (7%)
Add to Wish List
Add to Compare

Details

This pTH fragment stimulates adenylyl cyclase in ROS 17/2 rat osteosarcoma cells as strongly as pTH (1-34) (H-4835). However unlike pTH (1-34) it does not stimulate membrane-associated protein kinase C.
Catalog Number H-2274
One Letter Code SVSEIQLMHNLGKHLNSMERVEWLRKKLQDV
Molecular Formula C₁₆₂H₂₆₉N₄₉O₄₇S₂
Relative Molecular Mass 3719.35
CAS Registry Number [157938-23-3]
Source Synthetic
Storage Conditions -20 ± 5 °C
Areas of Interest Cancer Research
Links / Documents:
Brochures:
No brochures found.

Bachem product citations

K.M.Appleton et al., Methods Enzymol., 522, 229 (2013)
C.Klenk et al., J. Biol. Chem., 285, 8665 (2010)
M.Schnoke et al., Bone, 45, 590 (2009)
L.Qin et al., J. Biol. Chem., 280, 3104 (2005)
K.D.Ryder and R.L.Duncan, J. Bone Miner. Res., 16, 240 (2001)
S.M.Condon et al., J. Am. Chem. Soc., 122, 3007 (2000)

Product citations

H.Jouishomme et al., J. Bone Miner. Res., 9, 943 (1994)