×

Cookie Settings

We use cookies so that we can offer you the best possible website experience. This includes cookies which are necessary for the operations of the website, as well as cookies that are only used for anonymous statistical purposes, for comfort settings or to display personalized content. Please note that based on your settings, it is possible that not all functionalities of the website will be available. You can find further information in our privacy policy.

Please make your personal preference here:

Imprint

 
 
Shopping Cart - CHF 0.00

You have no items in your shopping cart.

  • Home  » 
  • 4025809
Return to Previous Page
4025809

Availability: In stock

pTH (1-31) (human)
H-Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-OH

4025809

Product No. Pack Size Available ADS InfoAnalytical Data Sheet List Price Online Order Price Qty
4025809.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 704.00
CHF 654.72 (7%)
4025809.1000 1 mg Ships within 3-5 business days  
CHF 1,261.00
CHF 1,172.73 (7%)

Details

pTH (1-31) stimulates adenylyl cyclase in ROS 17/2 rat osteosarcoma cells as strongly as pTH (1-34) (teriparatide). However unlike pTH (1-34) it does not stimulate membrane-associated protein kinase C.
Catalog Number H-2274
One Letter Code SVSEIQLMHNLGKHLNSMERVEWLRKKLQDV
Molecular Formula C₁₆₂H₂₆₉N₄₉O₄₇S₂
Relative Molecular Mass 3719.35
CAS Registry Number 157938-23-3
Source Synthetic
Storage Conditions -20 ± 5 °C
Application Cancer Research
Links / Documents:

Bachem product citations

K.M.Appleton et al., Methods Enzymol., 522, 229 (2013)
V.A.Siclari et al., Bone, 53, 575 (2013)
C.Klenk et al., J. Biol. Chem., 285, 8665 (2010)
M.Schnoke et al., Bone, 45, 590 (2009)
L.Qin et al., J. Biol. Chem., 280, 3104 (2005)
P.Misiano et al., Eur. J. Pharmacol., 469, 159 (2003)
K.D.Ryder and R.L.Duncan, J. Bone Miner. Res., 16, 240 (2001)
S.M.Condon et al., J. Am. Chem. Soc., 122, 3007 (2000)

Product citations

H.Jouishomme et al., J. Bone Miner. Res., 9, 943 (1994)