×

Cookie Settings

We use cookies so that we can offer you the best possible website experience. This includes cookies which are necessary for the operations of the website, as well as cookies that are only used for anonymous statistical purposes, for comfort settings or to display personalized content. Please note that based on your settings, it is possible that not all functionalities of the website will be available. You can find further information in our privacy policy.

Please make your personal preference here:

Imprint

 
 
Shopping Cart - CHF 0.00

You have no items in your shopping cart.

  • Home  » 
  • 4025495
Return to Previous Page
4025495

Availability: In stock

Defensin HNP-3 (human) trifluoroacetate salt
H-Asp-Cys-Tyr-Cys-Arg-Ile-Pro-Ala-Cys-Ile-Ala-Gly-Glu-Arg-Arg-Tyr-Gly-Thr-Cys-Ile-Tyr-Gln-Gly-Arg-Leu-Trp-Ala-Phe-Cys-Cys-OH trifluoroacetate salt (Disulfide bonds between Cys² and Cys³⁰/Cys⁴ and Cys¹⁹/Cys⁹ and Cys²⁹)

4025495

Product No. Pack Size Available ADS InfoAnalytical Data Sheet List Price Online Order Price Qty
4025495.0100 0.1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 184.00
CHF 171.12 (7%)
4025495.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 551.00
CHF 512.43 (7%)
4025495.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 1,019.00
CHF 947.67 (7%)
Catalog Number H-9860
One Letter Code DCYCRIPACIAGERRYGTCIYQGRLWAFCC
Synonyms HNP-3, Human Neutrophil Peptide-3
Molecular Formula C₁₅₁H₂₂₂N₄₄O₄₀S₆
Relative Molecular Mass 3486.09
CAS Registry Number 136661-76-2
Source Synthetic
Storage Conditions -20 ± 5 °C
Keywords Antimicrobial peptide
Application Antimicrobial & Antiviral Peptides
Links / Documents:
Brochures:

Bachem product citations

G.Paslakis et al., Nephron. Exp. Nephrol., 115, e96 (2010)

Product citations

F.T.Lundy et al., Oral Oncol., 40, 139 (2004)
Z.Wu et al., J. Pept. Res., 64, 118 (2004)
P.A.Raj et al., Biochem. J., 347, 633 (2000)