Defensin HNP-3 (human) 4025495

Return to Previous Page

Availability: In stock

Defensin HNP-3 (human) trifluoroacetate salt
H-Asp-Cys-Tyr-Cys-Arg-Ile-Pro-Ala-Cys-Ile-Ala-Gly-Glu-Arg-Arg-Tyr-Gly-Thr-Cys-Ile-Tyr-Gln-Gly-Arg-Leu-Trp-Ala-Phe-Cys-Cys-OH trifluoroacetate salt
(Disulfide bonds between Cys² and Cys³⁰/Cys⁴ and Cys¹⁹/Cys⁹ and Cys²⁹)

4025495

Product No.	Pack Size	Available	ADS InfoAnalytical Data Sheet	Unit Price	Online Order Price
4025495.0100	0.1 mg	Ships within 1 business day	ADSExemplary Data Sheet of a current available lot.	CHF 184.00	CHF 171.12 (7%)
4025495.0500	0.5 mg	Ships within 1 business day	ADSExemplary Data Sheet of a current available lot.	CHF 551.00	CHF 512.43 (7%)
4025495.1000	1 mg	Ships within 3-5 business days		CHF 1,019.00	CHF 947.67 (7%)

Add to Wish List

Add to Compare

Catalog Number H-9860

One Letter Code DCYCRIPACIAGERRYGTCIYQGRLWAFCC

Synonyms Human Neutrophil Peptide-3, HNP-3

Molecular Formula C₁₅₁H₂₂₂N₄₄O₄₀S₆

Relative Molecular Mass 3486.09

CAS Registry Number [136661-76-2] net

Source Synthetic

Storage Conditions -20 ± 5 °C

Keywords Antimicrobial peptide

Areas of Interest Antimicrobial & Antiviral Peptides

Links / Documents:

Brochures: