Shopping Cart - CHF 0.00

You have no items in your shopping cart.

  • Home  » 
  • 4025473
Return to Previous Page
4025473

Availability: In stock

Defensin HNP-1 (human) trifluoroacetate salt
H-Ala-Cys-Tyr-Cys-Arg-Ile-Pro-Ala-Cys-Ile-Ala-Gly-Glu-Arg-Arg-Tyr-Gly-Thr-Cys-Ile-Tyr-Gln-Gly-Arg-Leu-Trp-Ala-Phe-Cys-Cys-OH trifluoroacetate salt
(Disulfide bonds between Cys² and Cys³⁰/Cys⁴ and Cys¹⁹/Cys⁹ and Cys²⁹)

4025473

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
4025473.0100 0.1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 153.00
CHF 142.29 (7%)
4025473.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 612.00
CHF 569.16 (7%)
4025473.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 1,173.00
CHF 1,090.89 (7%)
Add to Wish List
Add to Compare
Catalog Number H-9855
APC Number 72-2-10
One Letter Code ACYCRIPACIAGERRYGTCIYQGRLWAFCC
Synonyms Human Neutrophil Peptide-1, HNP-1
Molecular Formula C₁₅₀H₂₂₂N₄₄O₃₈S₆
Relative Molecular Mass 3442.08
CAS Registry Number [148093-65-6] net
Source Synthetic
Storage Conditions -20 ± 5 °C
Keywords Antimicrobial peptide
Areas of Interest Antimicrobial & Antiviral Peptides
Links / Documents:
Brochures:

Bachem product citations

D.Gaspar et al., Biochim. Biophys. Acta, 1853, 308 (2015)
S.Tripathi et al., PLoS One, 10, e0124706 (2015)
S.Tripathi et al., PLoS One, 10, e0133454 (2015)
A.Bonucci et al., Biophys. Chem., 190-191, 32 (2014)
V.Tiriveedhi et al., Hum. Immunol., 75, 370 (2014)
A.Bonucci et al., Biochim. Biophys. Acta, 1828, 758 (2013)
T.Jin et al., Microbes Infect., 7, 1170 (2005)
C.Munk et al., AIDS Res. Hum. Retroviruses, 19, 875 (2003)
R.N.Cunliffe et al., J. Clin. Pathol., 55, 298 (2002)
G.Paone et al., Proc. Natl. Acad. Sci. U.S.A., 99, 8231 (2002)

Product citations

A.Bonucci et al., Biochim. Biophys. Acta, 1828, 758 (2013)
S.Sharma et al., Antimicrob. Agents Chemother., 45, 639 (2001)
P.A.Raj et al., Biochem. J., 347, 633 (2000)