×

Cookie Settings

We use cookies so that we can offer you the best possible website experience. This includes cookies which are necessary for the operations of the website, as well as cookies that are only used for anonymous statistical purposes, for comfort settings or to display personalized content. Please note that based on your settings, it is possible that not all functionalities of the website will be available. You can find further information in our privacy policy.

Please make your personal preference here:

Imprint

 
 
Shopping Cart - CHF 0.00

You have no items in your shopping cart.

  • Home  » 
  • 4025280
Return to Previous Page
4025280

Availability: In stock

IL-6 (88-121) (human)
H-Ile-Ile-Thr-Gly-Leu-Leu-Glu-Phe-Glu-Val-Tyr-Leu-Glu-Tyr-Leu-Gln-Asn-Arg-Phe-Glu-Ser-Ser-Glu-Glu-Gln-Ala-Arg-Ala-Val-Gln-Met-Ser-Thr-Lys-OH

4025280

Product No. Pack Size Available ADS InfoAnalytical Data Sheet List Price Online Order Price Qty
4025280.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 420.00
CHF 390.60 (7%)
4025280.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 735.00
CHF 683.55 (7%)

Details

IL-6 (88-121) competitively inhibits the binding of human IL-6 to its receptor by interacting with the IL-6 receptor to a significant degree. It is suggested that this peptide comprises a part of the receptor-binding region of IL-6.
Catalog Number H-1398
One Letter Code IITGLLEFEVYLEYLQNRFESSEEQARAVQMSTK
Synonyms Interleukin-6 (88-121) (human)
Molecular Formula C₁₇₉H₂₈₁N₄₅O₅₈S
Relative Molecular Mass 4023.53
CAS Registry Number 145990-81-4
Source Synthetic
Storage Conditions -20 ± 5 °C
Application Cytokines/Chemokines & their Receptors
Regenerative Medicine
Links / Documents:

Product citations

T.Ekida et al., Biochem. Biophys. Res. Commun., 189, 211 (1992)