Shopping Cart - CHF 0.00

You have no items in your shopping cart.

  • Home  » 
  • 4019602
Return to Previous Page
4019602

Availability: In stock

Exenatide acetate salt
H-His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH₂ acetate salt

4019602

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
4019602.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 291.00
CHF 270.63 (7%)
4019602.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 500.00
CHF 465.00 (7%)
Add to Wish List
Add to Compare

Details

Exendin-4 (exenatide), originally isolated from Heloderma suspectum venom, differs from exendin-3 by only 2 N-terminal amino acid substitutions. This polypeptide causes an increase in acinar cAMP without stimulating amylase release. Exendin-4 and glucagon-like peptide 1 (7-36) amide bind with similar affinity to the glucagon-like peptide 1 receptor. Moreover, exendin-4 is also considered for clinical use in the treatment of type 2 diabetes.
Catalog Number H-8730
APC Number 46-3-12
One Letter Code HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH₂
Synonyms Exendin-4
Molecular Formula C₁₈₄H₂₈₂N₅₀O₆₀S
Relative Molecular Mass 4186.63
CAS Registry Number [141758-74-9] net
Source Synthetic
Storage Conditions -20 ± 5 °C
Keywords GLP-1 agonist
Areas of Interest Diabetes
Parkinson’s Disease
Veterinary Medicine
Links / Documents:
Brochures:

Bachem product citations

S.J.Lee et al., Mol. Metab., 5, 552 (2016)
I.C.Rulifson et al., PLoS One, 11, e0147254 (2016)
E.M.Varin et al., Cell Death Dis., 7, e2065 (2016)
A.Jodal et al., PLoS One, 10, e0123443 (2015)
S.Kooijman et al., Diabetologia, 58, 2637 (2015)
D.Patel et al., Mol. Metab., 4, 253 (2015)
M.Pereira et al., Bone, 81, 459 (2015)
D.J.Baker et al., Br. J. Pharmacol., 171, 1629 (2014)
V.Hurtado-Carneiro et al., Mol. Neurobiol., 50, 314 (2014)
J.Taher et al., Mol. Metab., 3, 823 (2014)
J.M.Chehade et al., Metabolism, 62, 265 (2013)
K.L.Gatford et al., PLoS One, 8, e56553 (2013)
C.Gur et al., PLoS One, 8, e74033 (2013)
N.C.Liang et al., Int. J. Obes. (Lond), 37, 272 (2013)
T.R.Bomfim et al., J. Clin. Invest., 122, 1339 (2012)
W.K.Fenske et al., Int. J. Obes. (Lond), 36, 379 (2012)
W.K.Fenske et al., Int. J. Obes. (Lond.), 36, 379 (2012)
V.Hurtado-Carneiro et al., Mol. Neurobiol., 45, 348 (2012)
H.K.Salling et al., Regul. Pept., 178, 51 (2012)
E.Bojanowska and E.Radziszewska, J. Physiol. Pharmacol., 62, 395 (2011)
R.Kodera et al., Diabetologia, 54, 965 (2011)
N.T.Bello et al., Am. J. Physiol. Regul. Integr. Comp. Physiol., 299, R945 (2010)
L.Bjerre Knudsen et al., Endocrinology, 151, 1473 (2010)
J.Hsieh et al, Diabetologia, 53, 552 (2010)
J.R.Kehler et al., Bioanalysis, 2, 1461 (2010)
B.Nuche-Berenguer et al., J. Cell. Physiol., 225, 585 (2010)
L.R.Carraro-Lacroix et al., Am. J. Physiol. Renal Physiol., 297, F1647 (2009)
G.M.Holmes et al., J. Physiol., 587, 4749 (2009)
J.H.Kang et al., J. Endocrinol., 202, 65 (2009)
B.Martin et al., Diabetes, 58, 318 (2009)
L.Simonsen et al., Diabetes Obes. Metab., 11, 884 (2009)
J.Y.Yang et al., Diabetes, 58, 2596 (2009)
S.M.Gardiner et al., Br. J. Pharmacol., 154, 60 (2008)
D.P.Sonne et al., Regul. Pept., 146, 243 (2008)
L.Simonsen et al., Am. J. Physiol. Gastrointest. Liver Physiol., 293, G288 (2007)
T.S.McQuaid et al., J. Endocrinol., 190, 669 (2006)
C.Knauf et al., J. Clin. Invest., 115, 3554 (2005)
L.Li et al., Diabetologia, 48, 1339 (2005)
Q.Wang et al., Diabetologia, 47, 478 (2004)
S.Al-Sabah and D.Donnelly, FEBS Lett., 553, 342 (2003)
S.Al-Sabah and D.Donnelly, Br. J. Pharmacol., 140, 339 (2003)
B.Rolin et al., Am. J. Physiol. Endocrinol. Metab., 283, E745 (2002)
C.Tourrel et al., Diabetes, 51, 1443 (2002)

Product citations

I.Aviles-Olmos et al., J. Clin Invest., 123, 2730 (2013)
M.Marzioni et al., Gut, 58, 990 (2009)
G.Bertilsson et al., J. Neurosci. Res., 86, 326 (2008)
L.Brunetti et al., Peptides, 29, 1377 (2008)
N.Giannoukakis, Curr Opin Investig Drugs, 4, 459 (2003)
T.Perry and N.H.Greig, Trends Pharmacol. Sci., 24, 377 (2003)
H.C.Fehmann et al., Peptides, 15, 453 (1994)
J.Eng et al., J. Biol. Chem., 267, 7402 (1992)
Related products