×

Cookie Settings

We use cookies so that we can offer you the best possible website experience. This includes cookies which are necessary for the operations of the website, as well as cookies that are only used for anonymous statistical purposes, for comfort settings or to display personalized content. Please note that based on your settings, it is possible that not all functionalities of the website will be available. You can find further information in our privacy policy.

Please make your personal preference here:

Imprint

 
 
Shopping Cart - CHF 0.00

You have no items in your shopping cart.

  • Home  » 
  • 4019602
Return to Previous Page
4019602

Availability: In stock

Exenatide acetate salt
H-His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH₂ acetate salt

4019602

Product No. Pack Size Available ADS InfoAnalytical Data Sheet List Price Online Order Price Qty
4019602.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 291.00
CHF 270.63 (7%)
4019602.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 500.00
CHF 465.00 (7%)

Details

Exendin-4 (exenatide), originally isolated from Heloderma suspectum venom, differs from exendin-3 by only 2 N-terminal amino acid substitutions. This polypeptide causes an increase in acinar cAMP without stimulating amylase release. Exendin-4 and glucagon-like peptide 1 (7-36) amide bind with similar affinity to the glucagon-like peptide 1 receptor. Moreover, exendin-4 is also considered for clinical use in the treatment of type 2 diabetes.
Catalog Number H-8730
APC Number 46-3-12
One Letter Code HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH₂
Synonyms Exendin-4
Molecular Formula C₁₈₄H₂₈₂N₅₀O₆₀S
Relative Molecular Mass 4186.63
CAS Registry Number 141758-74-9
Source Synthetic
Storage Conditions -20 ± 5 °C
Keywords GLP-1 agonist
Application Diabetes
Parkinson's Disease
Veterinary Medicine
Links / Documents:
Brochures:

Bachem product citations

E.M.Varin et al., Cell Death Dis., 7, e2065 (2016)
I.C.Rulifson et al., PLoS One, 11, e0147254 (2016)
S.J.Lee et al., Mol. Metab., 5, 552 (2016)
A.Jodal et al., PLoS One, 10, e0123443 (2015)
D.Patel et al., Mol. Metab., 4, 253 (2015)
M.Pereira et al., Bone, 81, 459 (2015)
S.Kooijman et al., Diabetologia, 58, 2637 (2015)
W.W.Smith et al., PLoS One, 10, e0142314 (2015)
D.J.Baker et al., Br. J. Pharmacol., 171, 1629 (2014)
J.Taher et al., Mol. Metab., 3, 823 (2014)
V.Hurtado-Carneiro et al., Mol. Neurobiol., 50, 314 (2014)
C.Gur et al., PLoS One, 8, e74033 (2013)
J.M.Chehade et al., Metabolism, 62, 265 (2013)
K.L.Gatford et al., PLoS One, 8, e56553 (2013)
N.C.Liang et al., Int. J. Obes. (Lond), 37, 272 (2013)
B.Martin et al., J. Biol. Chem., 278, 31766 (2012)
D.Zhu et al., Cell Metab., 16, 238 (2012)
H.K.Salling et al., Regul. Pept., 178, 51 (2012)
T.R.Bomfim et al., J. Clin. Invest., 122, 1339 (2012)
V.Hurtado-Carneiro et al., Mol. Neurobiol., 45, 348 (2012)
W.K.Fenske et al., Int. J. Obes. (Lond), 36, 379 (2012)
W.K.Fenske et al., Int. J. Obes. (Lond.), 36, 379 (2012)
E.Bojanowska and E.Radziszewska, J. Physiol. Pharmacol., 62, 395 (2011)
J.Gao et al., Transpl. Int., 24, 1124 (2011)
R.Kodera et al., Diabetologia, 54, 965 (2011)
B.Nuche-Berenguer et al., J. Cell. Physiol., 225, 585 (2010)
J.Hsieh et al, Diabetologia, 53, 552 (2010)
J.R.Kehler et al., Bioanalysis, 2, 1461 (2010)
L.Bjerre Knudsen et al., Endocrinology, 151, 1473 (2010)
N.T.Bello et al., Am. J. Physiol. Regul. Integr. Comp. Physiol., 299, R945 (2010)
B.Martin et al., Diabetes, 58, 318 (2009)
G.M.Holmes et al., J. Physiol., 587, 4749 (2009)
J.H.Kang et al., J. Endocrinol., 202, 65 (2009)
J.Y.Yang et al., Diabetes, 58, 2596 (2009)
L.R.Carraro-Lacroix et al., Am. J. Physiol. Renal Physiol., 297, F1647 (2009)
L.Simonsen et al., Diabetes Obes. Metab., 11, 884 (2009)
D.P.Sonne et al., Regul. Pept., 146, 243 (2008)
S.M.Gardiner et al., Br. J. Pharmacol., 154, 60 (2008)
L.Simonsen et al., Am. J. Physiol. Gastrointest. Liver Physiol., 293, G288 (2007)
T.S.McQuaid et al., J. Endocrinol., 190, 669 (2006)
C.Knauf et al., J. Clin. Invest., 115, 3554 (2005)
L.Li et al., Diabetologia, 48, 1339 (2005)
Q.Wang et al., Diabetologia, 47, 478 (2004)
S.Al-Sabah and D.Donnelly, Br. J. Pharmacol., 140, 339 (2003)
S.Al-Sabah and D.Donnelly, FEBS Lett., 553, 342 (2003)
B.Rolin et al., Am. J. Physiol. Endocrinol. Metab., 283, E745 (2002)
B.Rolin et al., Am. J. Physiol. Endocrinol. Metab., 283, E754 (2002)
C.Tourrel et al., Diabetes, 51, 1443 (2002)
M.Nishizawa et al., J. Auton. Nerv. Syst., 80, 14 (2000)

Product citations

I.Aviles-Olmos et al., J. Clin Invest., 123, 2730 (2013)
M.Marzioni et al., Gut, 58, 990 (2009)
G.Bertilsson et al., J. Neurosci. Res., 86, 326 (2008)
L.Brunetti et al., Peptides, 29, 1377 (2008)
N.Giannoukakis, Curr Opin Investig Drugs, 4, 459 (2003)
T.Perry and N.H.Greig, Trends Pharmacol. Sci., 24, 377 (2003)
H.C.Fehmann et al., Peptides, 15, 453 (1994)
J.Eng et al., J. Biol. Chem., 267, 7402 (1992)
Related products