×

Cookie Settings

We use cookies so that we can offer you the best possible website experience. This includes cookies which are necessary for the operations of the website, as well as cookies that are only used for anonymous statistical purposes, for comfort settings or to display personalized content. Please note that based on your settings, it is possible that not all functionalities of the website will be available. You can find further information in our privacy policy.

Please make your personal preference here:

Imprint

 
 
Shopping Cart - CHF 0.00

You have no items in your shopping cart.

  • Home  » 
  • 4018358
Return to Previous Page
4018358

Availability: In stock

Amyloid β-Protein (1-43)
H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala-Thr-OH

4018358

Product No. Pack Size Available ADS InfoAnalytical Data Sheet List Price Online Order Price Qty
4018358.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 332.00
CHF 308.76 (7%)
4018358.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 552.00
CHF 513.36 (7%)

Details

The amyloid β-protein is a 39- to 43-amino acid polypeptide that is the primary constituent of senile plaques and cerebrovascular deposits in Alzheimer's disease and Down's syndrome. Additionally it acts as an inhibitor of the ubiquitin-dependent protein degradation in vitro.
Catalog Number H-1586
APC Number 62-0-83
One Letter Code DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIAT
Synonyms β-Amyloid (1-43)
Molecular Formula C₂₀₇H₃₁₈N₅₆O₆₂S
Relative Molecular Mass 4615.21
CAS Registry Number 134500-80-4
Source Synthetic
Storage Conditions -20 ± 5 °C
Application Alzheimer's Disease
Links / Documents:
Brochures:

Bachem product citations

V.Geylis et al., Neurobiol. Aging, 26, 597 (2005)
V.Kourilov and M.Steinitz, Anal. Biochem., 311, 166 (2002)

Product citations

L.Gregori et al., J. Biol. Chem., 270, 19702 (1995)
C.J.Pike et al., J. Neurosci., 13, 1676 (1993)
B.A.Yankner et al., Science, 250, 279 (1990)
D.Goldgaber et al., Science, 235, 877 (1987)