×

Cookie Settings

We use cookies so that we can offer you the best possible website experience. This includes cookies which are necessary for the operations of the website, as well as cookies that are only used for anonymous statistical purposes, for comfort settings or to display personalized content. Please note that based on your settings, it is possible that not all functionalities of the website will be available. You can find further information in our privacy policy.

Please make your personal preference here:

Imprint

 
 
Shopping Cart - CHF 0.00

You have no items in your shopping cart.

  • Home  » 
  • 4018327
Return to Previous Page
4018327

Availability: In stock

(Met(O)³⁵)-Amyloid β-Protein (1-40) trifluoroacetate salt
H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met(O)-Val-Gly-Gly-Val-Val-OH trifluoroacetate salt

4018327

Product No. Pack Size Available ADS InfoAnalytical Data Sheet List Price Online Order Price Qty
4018327.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 270.00
CHF 251.10 (7%)
4018327.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 449.00
CHF 417.57 (7%)

Details

Oxidation of Met35 attenuates the formation of Aβ40 oligomers.
Catalog Number H-7476
One Letter Code DAEFRHDSGYEVHHQKLVFFAEDVGFAMSNKGAIIGLM(O)VGGVV
Synonyms Amyloid β-Protein (1-40) sulfoxide
Molecular Formula C₁₉₄H₂₉₅N₅₃O₅₉S
Relative Molecular Mass 4345.86
CAS Registry Number 178302-50-6
Source Synthetic
Storage Conditions -20 ± 5 °C
Application Alzheimer's Disease
Links / Documents:
Brochures:

Product citations

A.M.Brown et al., Arch. Biochem. Biophys., 545, 44 (2014)
A.S.Johansson et al., NeuroReport, 18, 559 (2007)
L.Hou et al., J. Am. Chem. Soc., 126, 1992 (2004)
M.Palmblad et al., J. Biol. Chem., 277, 19506 (2002)