(Met(O)³⁵)-Amyloid β-Protein (1-40) 4018327

Return to Previous Page

Availability: In stock

(Met(O)³⁵)-Amyloid β-Protein (1-40) trifluoroacetate salt
H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met(O)-Val-Gly-Gly-Val-Val-OH trifluoroacetate salt

Product No.	Pack Size	Available	ADS InfoAnalytical Data Sheet	Unit Price	Online Order Price	Qty
4018327.0500	0.5 mg	Ships within 1 business day	ADSExemplary Data Sheet of a current available lot.	CHF 270.00	CHF 251.10 (7%)
4018327.1000	1 mg	Ships within 1 business day	ADSExemplary Data Sheet of a current available lot.	CHF 449.00	CHF 417.57 (7%)

Add to Wish List

Add to Compare

Oxidation of Met35 attenuates the formation of Aβ40 oligomers.

Catalog Number H-7476

One Letter Code DAEFRHDSGYEVHHQKLVFFAEDVGFAMSNKGAIIGLM(O)VGGVV

Synonyms Amyloid β-Protein (1-40) sulfoxide

Molecular Formula C₁₉₄H₂₉₅N₅₃O₅₉S

Relative Molecular Mass 4345.86

CAS Registry Number [178302-50-6] net

Source Synthetic

Storage Conditions -20 ± 5 °C

Areas of Interest Alzheimer's Disease

Links / Documents:

Brochures: