Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

BNP-32 (human) acetate salt
H-Ser-Pro-Lys-Met-Val-Gln-Gly-Ser-Gly-Cys-Phe-Gly-Arg-Lys-Met-Asp-Arg-Ile-Ser-Ser-Ser-Ser-Gly-Leu-Gly-Cys-Lys-Val-Leu-Arg-Arg-His-OH acetate salt (Disulfide bond)

4016567

Product No. Pack Size Available ADS InfoAnalytical Data Sheet List Price Online Order Price Qty
4016567.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 473.00
CHF 439.89 (7%)
4016567.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 840.00
CHF 781.20 (7%)

Details

The secretion of the cardiac hormone BNP-32 is increased considerably in patients with congestive heart failure, successful medical treatment of this condition will result in a decrease. Yandle et al. described a method for determining hBNP in human plasma. Effects of hBNP infusion in humans have been described by Holmes et al and La Villa et al. BNP is an important biomarker in the diagnosis of heart diseases. Additionally, BNP-32 may act as a neuropeptide. BNP-32 exerts strong lipolytic effects in humans.
Catalog Number H-9060
One Letter Code SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH
Synonyms BNP (1-32), human, Nesiritide, Brain Natriuretic Peptide-32 (human)
Molecular Formula C₁₄₃H₂₄₄N₅₀O₄₂S₄
Relative Molecular Mass 3464.09
CAS Registry Number 124584-08-3
Source Synthetic
Storage Conditions -20 ± 5 °C
Keywords Biomarker for cardiac diseases; Lipolysis-inducing peptide