×

Cookie Settings

We use cookies so that we can offer you the best possible website experience. This includes cookies which are necessary for the operations of the website, as well as cookies that are only used for anonymous statistical purposes, for comfort settings or to display personalized content. Please note that based on your settings, it is possible that not all functionalities of the website will be available. You can find further information in our privacy policy.

Please make your personal preference here:

Imprint

 
 
Shopping Cart - CHF 0.00

You have no items in your shopping cart.

  • Home  » 
  • 4015541
Return to Previous Page
4015541

Availability: In stock

ACTH (7-38) (human)
H-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-OH

4015541

Product No. Pack Size Available ADS InfoAnalytical Data Sheet List Price Online Order Price Qty
4015541.0500 0.5 mg Ships within 3-5 business days  
CHF 126.00
CHF 117.18 (7%)
4015541.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 210.00
CHF 195.30 (7%)
Catalog Number H-1205
APC Number 10-1-30
One Letter Code FRWGKPVGKKRRPVKVYPNGAEDESAEAFPLE
Synonyms Corticotropin-Inhibiting Peptide (CIP)
Molecular Formula C₁₆₇H₂₅₇N₄₇O₄₆
Relative Molecular Mass 3659.17
CAS Registry Number 68563-24-6
Source Synthetic
Storage Conditions -20 ± 5 °C
Links / Documents:
Brochures:

Product citations

C.H.Li et al., Proc. Natl. Acad. Sci. USA, 75, 4306 (1978)