Big Endothelin-1 (human) 4014579

Return to Previous Page

Availability: In stock

Big Endothelin-1 (human)
H-Cys-Ser-Cys-Ser-Ser-Leu-Met-Asp-Lys-Glu-Cys-Val-Tyr-Phe-Cys-His-Leu-Asp-Ile-Ile-Trp-Val-Asn-Thr-Pro-Glu-His-Val-Val-Pro-Tyr-Gly-Leu-Gly-Ser-Pro-Arg-Ser-OH
(Disulfide bonds between Cys¹ and Cys¹⁵/Cys³ and Cys¹¹)

4014579

Product No.	Pack Size	Available	ADS InfoAnalytical Data Sheet	Unit Price	Online Order Price	Qty
4014579.0500	0.5 mg	Ships within 1 business day	ADSExemplary Data Sheet of a current available lot.	CHF 630.00	CHF 585.90 (7%)
4014579.1000	1 mg	Ships within 1 business day	ADSExemplary Data Sheet of a current available lot.	CHF 1,051.00	CHF 977.43 (7%)

Add to Wish List

Add to Compare

Details

Human Big ET-1 comprises residues 53-90 of the endothelin precursor (preproendothelin). Compared to the mature endothelin-1 (hET-1), the peptide show less vasoconstrictor activity in vitro, but similar pressor effects in vivo.
Former CAS-number 121014-53-7.

Catalog Number H-9030

APC Number 88-1-30

One Letter Code CSCSSLMDKECVYFCHLDIIWVNTPEHVVPYGLGSPRS

Synonyms Big ET-1 (1-38) (human), Big Endothelin-1 (1-38), human

Molecular Formula C₁₈₉H₂₈₂N₄₈O₅₆S₅

Relative Molecular Mass 4282.94

CAS Registry Number [120796-97-6]

Source Synthetic

Storage Conditions -20 ± 5 °C

Keywords Endothelin precursor

Areas of Interest Cardiovascular System & Diseases

Links / Documents: