Calcitonin (human) 4014409 | Bachem https://shop.bachem.com/4014409.html

Return to Previous Page

Promobanner OCT 2020

Availability: In stock

Calcitonin (human) trifluoroacetate salt
H-Cys-Gly-Asn-Leu-Ser-Thr-Cys-Met-Leu-Gly-Thr-Tyr-Thr-Gln-Asp-Phe-Asn-Lys-Phe-His-Thr-Phe-Pro-Gln-Thr-Ala-Ile-Gly-Val-Gly-Ala-Pro-NH₂ trifluoroacetate salt (Disulfide bond)

4014409

Product No.	Pack Size	Available	ADS InfoAnalytical Data Sheet	List Price	Online Order Price	Qty
4014409.0001	1 mg	Ships within 1 business day	ADSExemplary Data Sheet of a current available lot.	CHF 168.00	CHF 156.24 (7%)
4014409.0005	5 mg	Ships within 1 business day	ADSExemplary Data Sheet of a current available lot.	CHF 672.00	CHF 624.96 (7%)

Details

Calcitonin is a peptide hormone involved in calcium and phosphorus homeostasis. Its inhibitory effect on osteoclast activity lowers blood calcium levels and positively influences bone mass density.

Catalog Number H-2250

APC Number 22-1-10

One Letter Code CGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAP-NH₂

Molecular Formula C₁₅₁H₂₂₆N₄₀O₄₅S₃

Relative Molecular Mass 3417.90

CAS Registry Number 21215-62-3

EINECS Number 244-276-2

Source Synthetic

Storage Conditions -20 ± 5 °C

Keywords Regulator of calcium and phosphorus homeostasis

Application Osteoporosis Research

Links / Documents: