Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

Peptide YY (human) trifluoroacetate salt
H-Tyr-Pro-Ile-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Asn-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH₂ trifluoroacetate salt

4013882

Product No. Pack Size Available ADS InfoAnalytical Data Sheet List Price Online Order Price Qty
4013882.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 263.00
CHF 244.59 (7%)
4013882.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 420.00
CHF 390.60 (7%)

Details

Peptide YY has been isolated from human colonic extracts. It is identical in sequence to porcine PYY except for two amino acid replacements.
Catalog Number H-9180
APC Number 48-0-30
One Letter Code YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH₂
Synonyms PYY (human)
Molecular Formula C₁₉₄H₂₉₅N₅₅O₅₇
Relative Molecular Mass 4309.81
CAS Registry Number [118997-30-1] net
Source Synthetic
Storage Conditions -20 ± 5 °C
Areas of Interest Gastrointestinal Research