×

Cookie Settings

We use cookies so that we can offer you the best possible website experience. This includes cookies which are necessary for the operations of the website, as well as cookies that are only used for anonymous statistical purposes, for comfort settings or to display personalized content. Please note that based on your settings, it is possible that not all functionalities of the website will be available. You can find further information in our privacy policy.

Please make your personal preference here:

Imprint

 
 
Shopping Cart - CHF 0.00

You have no items in your shopping cart.

  • Home  » 
  • 4013839
Return to Previous Page
4013839

Availability: In stock

PHM-27 (human) trifluoroacetate salt
H-His-Ala-Asp-Gly-Val-Phe-Thr-Ser-Asp-Phe-Ser-Lys-Leu-Leu-Gly-Gln-Leu-Ser-Ala-Lys-Lys-Tyr-Leu-Glu-Ser-Leu-Met-NH₂ trifluoroacetate salt

4013839

Product No. Pack Size Available ADS InfoAnalytical Data Sheet List Price Online Order Price Qty
4013839.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 420.00
CHF 390.60 (7%)

Details

PHM-27 differs only by 2 amino acids from PHI-27. The peptide is also closely related in sequence to VIP.
Catalog Number H-6355
APC Number 48-1-11
One Letter Code HADGVFTSDFSKLLGQLSAKKYLESLM-NH₂
Synonyms PHM-27/PHI, human
Molecular Formula C₁₃₅H₂₁₄N₃₄O₄₀S
Relative Molecular Mass 2985.46
CAS Registry Number 87403-73-4
Source Synthetic
Storage Conditions -20 ± 5 °C
Links / Documents:
Brochures:

Bachem product citations

D.Wootten et al., Br. J. Pharmacol., 168, 822 (2013)
F.M.Keane et al., FEBS J., 278, 1316 (2011)
T.Ziessen et al., Br. J. Pharmacol., 135, 546 (2002)

Product citations

M.Hoshino et al., FEBS Lett., 178, 233 (1984)
N.Itoh et al., Nature, 304, 547 (1983)