Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

PHM-27 (human) trifluoroacetate salt
H-His-Ala-Asp-Gly-Val-Phe-Thr-Ser-Asp-Phe-Ser-Lys-Leu-Leu-Gly-Gln-Leu-Ser-Ala-Lys-Lys-Tyr-Leu-Glu-Ser-Leu-Met-NH₂ trifluoroacetate salt

4013839

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
4013839.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 263.00
CHF 244.59 (7%)
4013839.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 420.00
CHF 390.60 (7%)
Add to Wish List
Add to Compare

Details

PHM-27 differs only by 2 amino acids from PHI-27. The peptide is also closely related in sequence to VIP.
Catalog Number H-6355
APC Number 48-1-11
One Letter Code HADGVFTSDFSKLLGQLSAKKYLESLM-NH₂
Synonyms PHM-27/PHI, human
Molecular Formula C₁₃₅H₂₁₄N₃₄O₄₀S
Relative Molecular Mass 2985.46
CAS Registry Number [87403-73-4] net
Source Synthetic
Storage Conditions -20 ± 5 °C