Shopping Cart - CHF 0.00

You have no items in your shopping cart.

  • Home  » 
  • 4012268
Return to Previous Page
4012268

Availability: In stock

Gastric Inhibitory Polypeptide (porcine) trifluoroacetate salt
H-Tyr-Ala-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-Arg-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Ser-Asp-Trp-Lys-His-Asn-Ile-Thr-Gln-OH trifluoroacetate salt

4012268

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
4012268.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 315.00
CHF 292.95 (7%)
4012268.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 578.00
CHF 537.54 (7%)
Add to Wish List
Add to Compare
Catalog Number H-6220
APC Number 46-4-30
One Letter Code YAEGTFISDYSIAMDKIRQQDFVNWLLAQKGKKSDWKHNITQ
Synonyms GIP (porcine), Glucose-Dependent Insulinotropic Polypeptide (porcine), Gastric Inhibitory Peptide, porcine
Molecular Formula C₂₂₅H₃₄₂N₆₀O₆₆S
Relative Molecular Mass 4975.62
CAS Registry Number [11063-17-5] net
Source Synthetic
Storage Conditions -20 ± 5 °C
Areas of Interest Diabetes
Links / Documents:
Brochures:
No brochures found.

Bachem product citations

A.Fulurija et al., PLoS One, 3, e3163 (2008)
S.K.Singh et al., Obesity (Silver Spring), 16, 2412 (2008)
C.F.Deacon et al., Am. J. Physiol. Endocrinol. Metab., 291, E468 (2006)
S.J.Kim et al., J. Biol. Chem., 280, 22297 (2005)
S.A.Hinke et al., Biochim. Biophys. Acta, 1547, 143 (2001)
R.W.Gelling et al., Regul. Pept., 69, 151 (1997)

Product citations

M.Bryer-Ash et al., Regul. Pept., 51, 101 (1994)
H.Joernvall et al., FEBS Lett., 123, 205 (1981)