×

Cookie Settings

We use cookies so that we can offer you the best possible website experience. This includes cookies which are necessary for the operations of the website, as well as cookies that are only used for anonymous statistical purposes, for comfort settings or to display personalized content. Please note that based on your settings, it is possible that not all functionalities of the website will be available. You can find further information in our privacy policy.

Please make your personal preference here:

Imprint

 
 
Shopping Cart - CHF 0.00

You have no items in your shopping cart.

  • Home  » 
  • 4011672
Return to Previous Page
4011672

Availability: In stock

GRP (porcine)
H-Ala-Pro-Val-Ser-Val-Gly-Gly-Gly-Thr-Val-Leu-Ala-Lys-Met-Tyr-Pro-Arg-Gly-Asn-His-Trp-Ala-Val-Gly-His-Leu-Met-NH₂

4011672

Product No. Pack Size Available ADS InfoAnalytical Data Sheet List Price Online Order Price Qty
4011672.1000 1 mg Ships within 3-5 business days  
CHF 368.00
CHF 342.24 (7%)
Catalog Number H-1635
APC Number 46-4-40
One Letter Code APVSVGGGTVLAKMYPRGNHWAVGHLM-NH₂
Synonyms Gastrin Releasing Peptide, porcine
Molecular Formula C₁₂₆H₁₉₈N₃₈O₃₁S₂
Relative Molecular Mass 2805.33
CAS Registry Number 74815-57-9
Source Synthetic
Storage Conditions -20 ± 5 °C
Application Gastrointestinal Research
Links / Documents: