×

Cookie Settings

We use cookies so that we can offer you the best possible website experience. This includes cookies which are necessary for the operations of the website, as well as cookies that are only used for anonymous statistical purposes, for comfort settings or to display personalized content. Please note that based on your settings, it is possible that not all functionalities of the website will be available. You can find further information in our privacy policy.

Please make your personal preference here:

Imprint

 
 
Shopping Cart - CHF 0.00

You have no items in your shopping cart.

  • Home  » 
  • 4011611
Return to Previous Page
4011611

Availability: In stock

VIP (human, mouse, rat) acetate salt
H-His-Ser-Asp-Ala-Val-Phe-Thr-Asp-Asn-Tyr-Thr-Arg-Leu-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Asn-Ser-Ile-Leu-Asn-NH₂ acetate salt

4011611

Product No. Pack Size Available ADS InfoAnalytical Data Sheet List Price Online Order Price Qty
4011611.0001 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 126.00
CHF 117.18 (7%)
4011611.0005 5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 504.00
CHF 468.72 (7%)

Details

VIP, a 28-amino acid peptide belonging to the secretin-glucagon-CRF family, is widely distributed in the central and peripheral nervous systems. Acting both as a neurotransmitter and as a hormone, VIP is involved in a wide variety of biological activities, including vaso- and bronchodilation, smooth muscle relaxation, and stimulation of secretion. An injectable formulation of this peptide in combination with the adrenergic drug phentolamine is expected to provide a new and effective alternative for erectile dysfunction patients.
Catalog Number H-3775
APC Number 48-1-10
One Letter Code HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH₂
Synonyms VIP, human, porcine, rat, ovine, Aviptadil
Molecular Formula C₁₄₇H₂₃₈N₄₄O₄₂S
Relative Molecular Mass 3325.84
CAS Registry Number 40077-57-4
Source Synthetic
Storage Conditions -20 ± 5 °C
Application Cardiovascular System & Diseases
Gastrointestinal Research
Links / Documents:
Brochures:

Bachem product citations

M.Bertolini et al., Br. J. Dermatol., 175, 531 (2016)
F.De Vadder et al., Neurogastroenterol. Motil., 27, 443 (2015)
J.M.Resch et al., Synapse, (2014)
A.S.Kauffman et al., Endocrinology, 155, 2222 (2014)
P.C.Gross et al., J. Pharm. Biomed. Anal., 88, 477 (2014)
R.C.Shoemaker et al., Health Manag. Technol., 5, 396 (2013)
D.I.Perez Sirkin et al., Tissue Cell, 45, 452 (2013)
D.Wootten et al., Br. J. Pharmacol., 168, 822 (2013)
F.Giordanetto et al., ACS Med. Chem. Lett., 4, 1163 (2013)
K.D.Keef et al., J. Physiol., 591, 1489 (2013)
Q.Li et al., Am. J. Physiol. Gastrointest. Liver Physiol., 305, G503 (2013)
S.Joshi et al., Br. J. Pharmacol., 170, 1092 (2013)
L.Fraccaroli et al., Clin. Exp. Immunol., 170, 310 (2012)
F.Verrier et al., Nat. Chem. Biol., 7, 909 (2011)
J.K.Tam et al., PLoS One, 6, e19384 (2011)
J.Schuy et al., Cells Tissues Organs, 193, 195 (2011)
S.A.Hamidi et al., Respir. Res., 12, 141 (2011)
S.Boswell et al., Immunology, 133, 278 (2011)
X.Jiang et al., Invest. Ophthalmol. Vis. Sci., 52, 6154 (2011)
A.Prasse et al., Am. J. Respir. Crit. Care Med., 182, 540 (2010)
C.P.Wayman et al., Br. J. Pharmacol., 160, 51 (2010)
E.A.Berger et al., Invest. Ophthalmol. Vis. Sci., 51, 5776 (2010)
G.Zaccone et al., Acta Histochem., 112, 328 (2010)
Y.Sheikine et al., Biochem. Biophys. Res. Commun., 402, 471 (2010)
H.Kalish and T.M.Phillips, J. Sep. Sci., 32, 1605 (2009)
P.Radziszewski et al., Gynecol. Endocrinol., 25, 362 (2009)
V.Vergote et al., Regul. Pept., 158, 97 (2009)
K.Freson et al., Blood, 111, 1885 (2008)
M.Dong et al., J. Mol. Neurosci., 36, 254 (2008)
M.Dong et al., Mol. Endocrinol., 22, 1489 (2008)
G.Zaccone et al., Anat. Rec. (Hoboken), 290, 1166 (2007)
L.Lajavardi et al., Invest. Ophthalmol. Vis. Sci., 48, 3230 (2007)
L.Lajavardi et al., Invest. Ophthalmol. Vis. Sci., 48, 3230 (2007)
M.Kumar et al., Stem Cells Dev., 16, 667 (2007)
C.Severi et al., Neurogastroenterol. Motil., 18, 1009 (2006)
T.M.Phillips and E.Wellner, J. Chromatogr. A., 1111, 106 (2006)
E.Persson and U.H.Lerner, Biochem. Biophys. Res. Commun., 335, 705 (2005)
E.Persson et al., Bone, 37, 513 (2005)
N.P.Hyland and H.M.Cox, Br. J. Pharmacol., 146, 712 (2005)
A.Costagliola et al., Auton. Neurosci., 112, 37 (2004)
M.D.Sans et al., Biochem. Biophys. Res. Commun., 319, 144 (2004)
S.Lonne-Rahm et al., Arch. Dermatol., 140, 1345 (2004)
A.G.Andreolotti et al., Eur. J. Biochem., 270, 4706 (2003)
C.M.Anderson et al., Br. J. Pharmacol., 138, 564 (2003)
J.M.Dick et al., J. Physiol., 538, 133 (2002)
L.T.Izu et al., J. Membr. Biol., 186, 145 (2002)
D.Bredenbroker et al., Eur. J. Pharmacol., 411, 319 (2001)
C.Otto et al., Mech. Dev., 94, 111 (2000)
T.Ito et al., Am. J. Physiol. Gastrointest. Liver Physiol., 278, G64 (2000)
V.Carnicelli et al., Cell Signal, 12, 683 (2000)
G.Gololobov et al., Mol. Immunol., 36, 1215 (1999)
H.P.Hauri et al., Eur. J. Biochem., 219, 539 (1994)

Product citations

W.I.Said et al., Peptides, 28, 1620 (2007)
V.Sethi et al., Meth. Enzymol., 391, 377 (2005)
V.Petkov et al., J. Clin. Invest., 111, 1339 (2003)
G.B.Keijzers, Curr Opin Investig Drugs, 2, 545 (2001)
S.I.Said, Am. Rev. Respir. Dis., 143, S22 (1991)
E.J.Goetzl et al., Ann. N. Y. Acad. Sci., 594, 34 (1990)
G.D.Wenger et al., Ann. N. Y. Acad. Sci., 594, 104 (1990)
I.Gozes and D.E.Brenneman, Mol. Neurobiol., 3, 201 (1989)
J.Fahrenkrug, Pharmac. Ther., 41, 515 (1989)
Related products