Shopping Cart - CHF 0.00

You have no items in your shopping cart.

  • Home  » 
  • 4011611
Return to Previous Page
4011611

Availability: In stock

VIP (human, mouse, rat) acetate salt
H-His-Ser-Asp-Ala-Val-Phe-Thr-Asp-Asn-Tyr-Thr-Arg-Leu-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Asn-Ser-Ile-Leu-Asn-NH₂ acetate salt

4011611

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
4011611.0001 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 126.00
CHF 117.18 (7%)
4011611.0005 5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 504.00
CHF 468.72 (7%)
Add to Wish List
Add to Compare

Details

VIP, a 28-amino acid peptide belonging to the secretin-glucagon-CRF family, is widely distributed in the central and peripheral nervous systems. Acting both as a neurotransmitter and as a hormone, VIP is involved in a wide variety of biological activities, including vaso- and bronchodilation, smooth muscle relaxation, and stimulation of secretion. An injectable formulation of this peptide in combination with the adrenergic drug phentolamine is expected to provide a new and effective alternative for erectile dysfunction patients.
Catalog Number H-3775
APC Number 48-1-10
One Letter Code HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH₂
Synonyms Aviptadil, VIP, human, porcine, rat, ovine
Molecular Formula C₁₄₇H₂₃₈N₄₄O₄₂S
Relative Molecular Mass 3325.84
CAS Registry Number [40077-57-4] net
Source Synthetic
Storage Conditions -20 ± 5 °C
Areas of Interest Cardiovascular System & Diseases
Gastrointestinal Research
Links / Documents:
Brochures:

Bachem product citations

M.Bertolini et al., Br. J. Dermatol., 175, 531 (2016)
T.W.Carion et al., Invest. Ophthalmol. Vis. Sci., 56, 6932 (2015)
F.De Vadder et al., Neurogastroenterol. Motil., 27, 443 (2015)
J.M.Resch et al., Synapse, (2014)
P.C.Gross et al., J. Pharm. Biomed. Anal., 88, 477 (2014)
A.S.Kauffman et al., Endocrinology, 155, 2222 (2014)
J.M.Yoder et al., Am. J. Physiol. Regul. Integr. Comp. Physiol., 306, R837 (2014)
R.C.Shoemaker et al., Health Manag. Technol., 5, 396 (2013)
F.Giordanetto et al., ACS Med. Chem. Lett., 4, 1163 (2013)
S.Joshi et al., Br. J. Pharmacol., 170, 1092 (2013)
K.D.Keef et al., J. Physiol., 591, 1489 (2013)
Q.Li et al., Am. J. Physiol. Gastrointest. Liver Physiol., 305, G503 (2013)
D.I.Perez Sirkin et al., Tissue Cell, 45, 452 (2013)
D.Wootten et al., Br. J. Pharmacol., 168, 822 (2013)
L.Fraccaroli et al., Clin. Exp. Immunol., 170, 310 (2012)
B.Yusta et al., Endocrinology, 153, 2623 (2012)
S.Boswell et al., Immunology, 133, 278 (2011)
S.A.Hamidi et al., Respir. Res., 12, 141 (2011)
X.Jiang et al., Invest. Ophthalmol. Vis. Sci., 52, 6154 (2011)
J.Schuy et al., Cells Tissues Organs, 193, 195 (2011)
J.K.Tam et al., PLoS One, 6, e19384 (2011)
F.Verrier et al., Nat. Chem. Biol., 7, 909 (2011)
E.A.Berger et al., Invest. Ophthalmol. Vis. Sci., 51, 5776 (2010)
E.A.Berger et al., Invest. Ophthalmol. Vis. Sci., 51, 5776 (2010)
E.A.Berger et al., Invest. Ophthalmol. Vis. Sci., 51, 5776 (2010)
A.Prasse et al., Am. J. Respir. Crit. Care Med., 182, 540 (2010)
Y.Sheikine et al., Biochem. Biophys. Res. Commun., 402, 471 (2010)
C.P.Wayman et al., Br. J. Pharmacol., 160, 51 (2010)
G.Zaccone et al., Acta Histochem., 112, 328 (2010)
H.Kalish and T.M.Phillips, J. Sep. Sci., 32, 1605 (2009)
P.Radziszewski et al., Gynecol. Endocrinol., 25, 362 (2009)
V.Vergote et al., Regul. Pept., 158, 97 (2009)
M.Dong et al., J. Mol. Neurosci., 36, 254 (2008)
M.Dong et al., Mol. Endocrinol., 22, 1489 (2008)
K.Freson et al., Blood, 111, 1885 (2008)
M.Kumar et al., Stem Cells Dev., 16, 667 (2007)
L.Lajavardi et al., Invest. Ophthalmol. Vis. Sci., 48, 3230 (2007)
L.Lajavardi et al., Invest. Ophthalmol. Vis. Sci., 48, 3230 (2007)
G.Zaccone et al., Anat. Rec. (Hoboken), 290, 1166 (2007)
T.M.Phillips and E.Wellner, J. Chromatogr. A., 1111, 106 (2006)
C.Severi et al., Neurogastroenterol. Motil., 18, 1009 (2006)
N.P.Hyland and H.M.Cox, Br. J. Pharmacol., 146, 712 (2005)
E.Persson and U.H.Lerner, Biochem. Biophys. Res. Commun., 335, 705 (2005)
E.Persson et al., Bone, 37, 513 (2005)
A.Costagliola et al., Auton. Neurosci., 112, 37 (2004)
S.Lonne-Rahm et al., Arch. Dermatol., 140, 1345 (2004)
M.D.Sans et al., Biochem. Biophys. Res. Commun., 319, 144 (2004)
C.M.Anderson et al., Br. J. Pharmacol., 138, 564 (2003)
A.G.Andreolotti et al., Eur. J. Biochem., 270, 4706 (2003)
J.M.Dick et al., J. Physiol., 538, 133 (2002)
L.T.Izu et al., J. Membr. Biol., 186, 145 (2002)
D.Bredenbroker et al., Eur. J. Pharmacol., 411, 319 (2001)
V.Carnicelli et al., Cell Signal, 12, 683 (2000)
T.Ito et al., Am. J. Physiol. Gastrointest. Liver Physiol., 278, G64 (2000)
C.Otto et al., Mech. Dev., 94, 111 (2000)
G.Gololobov et al., Mol. Immunol., 36, 1215 (1999)
H.P.Hauri et al., Eur. J. Biochem., 219, 539 (1994)

Product citations

W.I.Said et al., Peptides, 28, 1620 (2007)
V.Sethi et al., Meth. Enzymol., 391, 377 (2005)
V.Petkov et al., J. Clin. Invest., 111, 1339 (2003)
G.B.Keijzers, Curr Opin Investig Drugs, 2, 545 (2001)
S.I.Said, Am. Rev. Respir. Dis., 143, S22 (1991)
E.J.Goetzl et al., Ann. N. Y. Acad. Sci., 594, 34 (1990)
G.D.Wenger et al., Ann. N. Y. Acad. Sci., 594, 104 (1990)
J.Fahrenkrug, Pharmac. Ther., 41, 515 (1989)
I.Gozes and D.E.Brenneman, Mol. Neurobiol., 3, 201 (1989)
Related products