Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

pTH (1-34) (human) acetate salt
H-Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-OH acetate salt

4011474

Product No. Pack Size Available ADS InfoAnalytical Data Sheet List Price Online Order Price Qty
4011474.0001 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 210.00
CHF 195.30 (7%)
4011474.0005 5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 840.00
CHF 781.20 (7%)

Details

Teriparatide, which consists of the N-terminal 34 amino acid residues of parathyroid hormone, shows the same potency and pharmacological profile as the native hormone. Administration of teriparatide stimulates bone formation and increases the bone mineral density (BMD).
Catalog Number H-4835
One Letter Code SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF
Synonyms Parathyroid Hormone (1-34), human, Teriparatide
Molecular Formula C₁₈₁H₂₉₁N₅₅O₅₁S₂
Relative Molecular Mass 4117.77
CAS Registry Number 52232-67-4
Source Synthetic
Storage Conditions -20 ± 5 °C

Bachem product citations

S.M.Condon et al., J. Am. Chem. Soc., 122, 3007 (2000)