GRF (human) 4011472

Return to Previous Page

Availability: In stock

GRF (human) acetate salt
H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-Gln-Gln-Gly-Glu-Ser-Asn-Gln-Glu-Arg-Gly-Ala-Arg-Ala-Arg-Leu-NH₂ acetate salt

4011472

Product No.	Pack Size	Available	ADS InfoAnalytical Data Sheet	Unit Price	Online Order Price	Qty
4011472.0001	1 mg	Ships within 1 business day	ADSExemplary Data Sheet of a current available lot.	CHF 315.00	CHF 292.95 (7%)
4011472.0005	5 mg	Ships within 1 business day	ADSExemplary Data Sheet of a current available lot.	CHF 1,261.00	CHF 1,172.73 (7%)

Add to Wish List

Add to Compare

Details

GRF is the hypothalamic peptide hormone that specifically stimulates synthesis and release of the growth hormone by somatotropic cells of the anterior pituitary gland.

Catalog Number H-3695

APC Number 52-1-50

One Letter Code YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH₂

Synonyms Somatorelin, Growth Hormone-Releasing Factor (human), Growth Hormone-Releasing Hormone (human), GHRH (human), Somatoliberin (human), Somatocrinin (human), GHRF (1-44), human

Molecular Formula C₂₁₅H₃₅₈N₇₂O₆₆S

Relative Molecular Mass 5039.72

CAS Registry Number [83930-13-6] net

Source Synthetic

Storage Conditions -20 ± 5 °C

Areas of Interest Pituitary & Hypothalamic Hormones
Regenerative Medicine

Links / Documents:

Brochures:

No brochures found.