GRF (human) 4011472

Return to Previous Page

Availability: In stock

GRF (human) acetate salt
H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-Gln-Gln-Gly-Glu-Ser-Asn-Gln-Glu-Arg-Gly-Ala-Arg-Ala-Arg-Leu-NH₂ acetate salt

4011472

Product No.	Pack Size	Available	ADS InfoAnalytical Data Sheet	List Price	Online Order Price	Qty
4011472.0001	1 mg	Ships within 1 business day	ADSExemplary Data Sheet of a current available lot.	CHF 315.00	CHF 292.95 (7%)
4011472.0005	5 mg	Ships within 1 business day	ADSExemplary Data Sheet of a current available lot.	CHF 1,261.00	CHF 1,172.73 (7%)

Details

GRF is the hypothalamic peptide hormone that specifically stimulates synthesis and release of the growth hormone by somatotropic cells of the anterior pituitary gland.

Catalog Number H-3695

APC Number 52-1-50

One Letter Code YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH₂

Synonyms Somatorelin, Growth Hormone-Releasing Factor (human), Growth Hormone-Releasing Hormone (human), GHRH (human), Somatoliberin (human), Somatocrinin (human), GHRF (1-44), human

Molecular Formula C₂₁₅H₃₅₈N₇₂O₆₆S

Relative Molecular Mass 5039.72

CAS Registry Number [83930-13-6] net

Source Synthetic

Storage Conditions -20 ± 5 °C

Areas of Interest Pituitary & Hypothalamic Hormones
Regenerative Medicine

Links / Documents:

Brochures:

No brochures found.