Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

GRF (human) acetate salt
H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-Gln-Gln-Gly-Glu-Ser-Asn-Gln-Glu-Arg-Gly-Ala-Arg-Ala-Arg-Leu-NH₂ acetate salt

4011472

Product No. Pack Size Available ADS InfoAnalytical Data Sheet List Price Online Order Price Qty
4011472.0001 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 315.00
CHF 292.95 (7%)
4011472.0005 5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 1,261.00
CHF 1,172.73 (7%)

Details

GRF is the hypothalamic peptide hormone that specifically stimulates synthesis and release of the growth hormone by somatotropic cells of the anterior pituitary gland.
Catalog Number H-3695
APC Number 52-1-50
One Letter Code YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH₂
Synonyms Somatorelin, Growth Hormone-Releasing Factor (human), Growth Hormone-Releasing Hormone (human), GHRH (human), Somatoliberin (human), Somatocrinin (human), GHRF (1-44), human
Molecular Formula C₂₁₅H₃₅₈N₇₂O₆₆S
Relative Molecular Mass 5039.72
CAS Registry Number [83930-13-6] net
Source Synthetic
Storage Conditions -20 ± 5 °C