Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

VIP Antagonist
H-Lys-Pro-Arg-Arg-Pro-Tyr-Thr-Asp-Asn-Tyr-Thr-Arg-Leu-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Asn-Ser-Ile-Leu-Asn-NH₂

H-9935

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-9935.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 258.00
CHF 239.94 (7%)
H-9935.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 464.00
CHF 431.52 (7%)
Add to Wish List
Add to Compare

Details

VIP antagonist, a hybrid of neurotensin (6-11) and VIP (7-28), is a competitive antagonist of VIP-binding to glial cells. In rats with reduced masculine potential, The peptide markedly inhibits VIP-stimulated sexual behaviour. Furthermore, it has been shown to antagonize VIP receptors on non-small cell lung cancer cells, thereby inhibiting tumor growth in vitro and in vivo.
Item Number 4031352
APC Number 48-6-31
One Letter Code KPRRPYTDNYTRLRKQMAVKKYLNSILN-NH₂
Synonyms [Lys1, Pro2,5, Arg3,4, Tyr6] VIP, human, porcine, rat, ovine
Molecular Formula C₁₅₄H₂₅₇N₄₉O₄₀S
Relative Molecular Mass 3467.11
CAS Registry Number [125093-93-8]
Source Synthetic
Storage Conditions -20 ± 5 °C
Areas of Interest Cancer Research