Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

Defensin HNP-3 (human) trifluoroacetate salt
H-Asp-Cys-Tyr-Cys-Arg-Ile-Pro-Ala-Cys-Ile-Ala-Gly-Glu-Arg-Arg-Tyr-Gly-Thr-Cys-Ile-Tyr-Gln-Gly-Arg-Leu-Trp-Ala-Phe-Cys-Cys-OH trifluoroacetate salt
(Disulfide bonds between Cys² and Cys³⁰/Cys⁴ and Cys¹⁹/Cys⁹ and Cys²⁹)

H-9860

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-9860.0100 0.1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 180.00
CHF 167.40 (7%)
H-9860.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 540.00
CHF 502.20 (7%)
H-9860.1000 1 mg Ships within 3-5 business days  
CHF 999.00
CHF 929.07 (7%)
Add to Wish List
Add to Compare
Item Number 4025495
One Letter Code DCYCRIPACIAGERRYGTCIYQGRLWAFCC
Synonyms Human Neutrophil Peptide-3, HNP-3
Molecular Formula C₁₅₁H₂₂₂N₄₄O₄₀S₆
Relative Molecular Mass 3486.09
CAS Registry Number [136661-76-2] net
Source Synthetic
Storage Conditions -20 ± 5 °C
Keywords Antimicrobial peptide