Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

rec Monocyte IL-8 (human)
H-Ser-Ala-Lys-Glu-Leu-Arg-Cys-Gln-Cys-Ile-Lys-Thr-Tyr-Ser-Lys-Pro-Phe-His-Pro-Lys-Phe-Ile-Lys-Glu-Leu-Arg-Val-Ile-Glu-Ser-Gly-Pro-His-Cys-Ala-Asn-Thr-Glu-Ile-Ile-Val-Lys-Leu-Ser-Asp-Gly-Arg-Glu-Leu-Cys-Leu-Asp-Pro-Lys-Glu-Asn-Trp-Val-Gln-Arg-Val-Val-Glu-Lys-Phe-Leu-Lys-Arg-Ala-Glu-Asn-Ser-OH
(Disulfide bonds between Cys⁷ and Cys³⁴/Cys⁹ and Cys⁵⁰)

H-9625

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-9625.0005 5 µg Ships within 3-5 business days  
CHF 113.00
CHF 105.09 (7%)
H-9625.0025 25 µg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 299.00
CHF 278.07 (7%)
Add to Wish List
Add to Compare

Details

approx. EC₅₀ = 3.0 nM / migration 0.13 nM = 0.91 ng/mL
IL-8 is also known as neutrophil activating factor (NAF), monocyte-derived neutrophil chemotactic factor, and T-cell chemotactic factor. Monocyte interleukin-8 contains 72 amino acids and shows higher potency than endothelial IL8 in chemotaxis and degranulation.
Item Number 4030794
One Letter Code SAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS
Synonyms rec Monocyte Interleukin-8 (human), Emoctakin
Molecular Formula C₃₇₂H₆₀₀N₁₀₆O₁₀₆S₄
Relative Molecular Mass 8381.77
CAS Registry Number [142298-00-8]
Source Recombinant
Storage Conditions -20 ± 5 °C
Keywords Recombinant protein