Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

Anthopleurin-A
H-Gly-Val-Ser-Cys-Leu-Cys-Asp-Ser-Asp-Gly-Pro-Ser-Val-Arg-Gly-Asn-Thr-Leu-Ser-Gly-Thr-Leu-Trp-Leu-Tyr-Pro-Ser-Gly-Cys-Pro-Ser-Gly-Trp-His-Asn-Cys-Lys-Ala-His-Gly-Pro-Thr-Ile-Gly-Trp-Cys-Cys-Lys-Gln-OH
(Disulfide bonds between Cys⁴ and Cys⁴⁶/Cys⁶ and Cys³⁶/Cys²⁹ and Cys⁴⁷)

H-9590

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-9590.0100 0.1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 206.00
CHF 191.58 (7%)
H-9590.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 824.00
CHF 766.32 (7%)
Add to Wish List
Add to Compare

Details

Anthopleurin-A (AP-A) has been isolated from the sea anemone, Anthopleura xanthogrammica, and was found to have inotropic but no chronotropic effects on mammalian heart preparation.
Item Number 4030365
One Letter Code GVSCLCDSDGPSVRGNTLSGTLWLYPSGCPSGWHNCKAHGPTIGWCCKQ
Molecular Formula C₂₂₀H₃₂₆N₆₄O₆₇S₆
Relative Molecular Mass 5131.80
CAS Registry Number [60880-63-9]
Source Synthetic
Storage Conditions -20 ± 5 °C
Keywords Sea anemone peptide

Product citations

W.R.Kem et al., Eliat Symposium on Marine Pharmacology, p. 98, P.Lazarovici, ed., Alaken Inc., Ft. Collins, (1996)