Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

GLP-1 (7-37) (human, bovine, guinea pig, mouse, rat) acetate salt
H-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly-OH acetate salt

H-9560

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-9560.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 628.00
CHF 584.04 (7%)
H-9560.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 1'133.00
CHF 1'053.69 (7%)
Add to Wish List
Add to Compare

Details

An insulinotropic peptide generated by proteolytic cleavage of its precursor GLP-1 (1-37) and secreted by L cells of the intestinal mucosa upon food ingestion.
Item Number 4043014
APC Number 46-1-28
One Letter Code HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG
Synonyms Insulinotropin acetate salt, Glucagon-Like Peptide 1 (7-37), Proglucagon (78-108), Preproglucagon (98-128)
Molecular Formula C₁₅₁H₂₂₈N₄₀O₄₇
Relative Molecular Mass 3355.71
CAS Registry Number [106612-94-6] net
Source Synthetic
Storage Conditions -20 ± 5 °C
Keywords Insulinotropic hormone; Incretin
Areas of Interest Diabetes