Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

Amylin (mouse, rat) trifluoroacetate salt
H-Lys-Cys-Asn-Thr-Ala-Thr-Cys-Ala-Thr-Gln-Arg-Leu-Ala-Asn-Phe-Leu-Val-Arg-Ser-Ser-Asn-Asn-Leu-Gly-Pro-Val-Leu-Pro-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Tyr-NH₂ trifluoroacetate salt
(Disulfide bond)

H-9475

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-9475.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 309.00
CHF 287.37 (7%)
H-9475.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 515.00
CHF 478.95 (7%)
Add to Wish List
Add to Compare

Details

Rat amylin (rIAPP) lacks the fibril-forming capacity of human amylin (hIAPP). As a consequence, toxic effects have been reported for the human but not for the rat peptide amide.
Item Number 4030201
APC Number 74-5-10
One Letter Code KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY-NH₂
Synonyms IAPP (mouse, rat), Islet amyloid polypeptide (mouse, rat)
Molecular Formula C₁₆₇H₂₇₂N₅₂O₅₃S₂
Relative Molecular Mass 3920.45
CAS Registry Number [124447-81-0] net
Source Synthetic
Storage Conditions -20 ± 5 °C
Keywords Peptide hormone
Areas of Interest Diabetes

Bachem product citations