Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

Peptide YY (human) trifluoroacetate salt
H-Tyr-Pro-Ile-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Asn-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH₂ trifluoroacetate salt

H-9180

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-9180.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 263.00
CHF 244.59 (7%)
H-9180.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 420.00
CHF 390.60 (7%)
Add to Wish List
Add to Compare

Details

Peptide YY has been isolated from human colonic extracts. It is identical in sequence to porcine PYY except for two amino acid replacements.
Item Number 4013882
APC Number 48-0-30
One Letter Code YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH₂
Synonyms PYY (human)
Molecular Formula C₁₉₄H₂₉₅N₅₅O₅₇
Relative Molecular Mass 4309.81
CAS Registry Number [118997-30-1] net
Source Synthetic
Storage Conditions -20 ± 5 °C
Areas of Interest Gastrointestinal Research