Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

pTH-Related Protein Splice Isoform 3 (140-173) (human) trifluoroacetate salt
H-Thr-Ala-Leu-Leu-Trp-Gly-Leu-Lys-Lys-Lys-Lys-Glu-Asn-Asn-Arg-Arg-Thr-His-His-Met-Gln-Leu-Met-Ile-Ser-Leu-Phe-Lys-Ser-Pro-Leu-Leu-Leu-Leu-OH trifluoroacetate salt

H-9105

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-9105.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 206.00
CHF 191.58 (7%)
H-9105.1000 1 mg Ships within 3-5 business days  
CHF 350.00
CHF 325.50 (7%)
Add to Wish List
Add to Compare
Item Number 4015593
One Letter Code TALLWGLKKKKENNRRTHHMQLMISLFKSPLLLL
Synonyms pTH-rP Splice Isoform 3 (140-173) (human), Hypercalcemia of Malignancy Factor Splice Isoform 3 (140-173) (human)
Molecular Formula C₁₈₆H₃₁₃N₅₃O₄₄S₂
Relative Molecular Mass 4059.99
CAS Registry Number [139872-85-8] net
Source Synthetic
Storage Conditions -20 ± 5 °C