Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

Big Endothelin-1 (human)
H-Cys-Ser-Cys-Ser-Ser-Leu-Met-Asp-Lys-Glu-Cys-Val-Tyr-Phe-Cys-His-Leu-Asp-Ile-Ile-Trp-Val-Asn-Thr-Pro-Glu-His-Val-Val-Pro-Tyr-Gly-Leu-Gly-Ser-Pro-Arg-Ser-OH
(Disulfide bonds between Cys¹ and Cys¹⁵/Cys³ and Cys¹¹)

H-9030

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-9030.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 618.00
CHF 574.74 (7%)
H-9030.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 1'030.00
CHF 957.90 (7%)
Add to Wish List
Add to Compare

Details

Human Big ET-1 comprises residues 53-90 of the endothelin precursor (preproendothelin). Compared to the mature endothelin-1 (hET-1), the peptide show less vasoconstrictor activity in vitro, but similar pressor effects in vivo.
Former CAS-number 121014-53-7.
Item Number 4014579
APC Number 88-1-30
One Letter Code CSCSSLMDKECVYFCHLDIIWVNTPEHVVPYGLGSPRS
Synonyms Big ET-1 (1-38) (human), Big Endothelin-1 (1-38), human
Molecular Formula C₁₈₉H₂₈₂N₄₈O₅₆S₅
Relative Molecular Mass 4282.94
CAS Registry Number [120796-97-6]
Source Synthetic
Storage Conditions -20 ± 5 °C
Keywords Endothelin precursor