Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

Echistatin
H-Glu-Cys-Glu-Ser-Gly-Pro-Cys-Cys-Arg-Asn-Cys-Lys-Phe-Leu-Lys-Glu-Gly-Thr-Ile-Cys-Lys-Arg-Ala-Arg-Gly-Asp-Asp-Met-Asp-Asp-Tyr-Cys-Asn-Gly-Lys-Thr-Cys-Asp-Cys-Pro-Arg-Asn-Pro-His-Lys-Gly-Pro-Ala-Thr-OH
(Disulfide bonds between Cys² and Cys¹¹/Cys⁷ and Cys³²/Cys⁸ and Cys³⁷/Cys²⁰ and Cys³⁹)

H-9010

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-9010.0100 0.1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 381.00
CHF 354.33 (7%)
H-9010.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 1'524.00
CHF 1'417.32 (7%)
Add to Wish List
Add to Compare

Details

Echistatin is a 49-amino acid polypeptide from the venom of the saw-scaled viper, Echis carinatus. The peptide containing an RGD motif binds to the glycoprotein IIb/IIIa receptor on the platelet and is a potent competitive inhibitor of ADPstimulated platelet aggregation mediated by fibrinogen and other factors. Furthermore, echistatin effectively inhibits osteoclastic bone resorption in vitro and in vivo.
Item Number 4030571
One Letter Code ECESGPCCRNCKFLKEGTICKRARGDDMDDYCNGKTCDCPRNPHKGPAT
Molecular Formula C₂₁₇H₃₄₁N₇₁O₇₄S₉
Relative Molecular Mass 5417.12
CAS Registry Number [154303-05-6]
Source Synthetic
Storage Conditions -20 ± 5 °C
Areas of Interest Hematology
Osteoporosis Research