Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

Steroidogenesis-Activator Polypeptide (rat)
H-Ile-Val-Gln-Pro-Ile-Ile-Ser-Lys-Leu-Tyr-Gly-Ser-Gly-Gly-Pro-Pro-Pro-Thr-Gly-Glu-Glu-Asp-Thr-Asp-Glu-Lys-Lys-Asp-Glu-Leu-OH

H-8855

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-8855.0500 0.5 mg Ships within 1 business day  
CHF 783.00
CHF 728.19 (7%)
H-8855.1000 1 mg Ships within 3-5 business days  
CHF 1'401.00
CHF 1'302.93 (7%)
Add to Wish List
Add to Compare

Details

Steroidogenesis-activator polypeptide (SAPP), which has been isolated from a rat Leydig cell tumor, activates steroid biosynthesis.
Item Number 4031284
One Letter Code IVQPIISKLYGSGGPPPTGEEDTDEKKDEL
Synonyms SAPP (rat), Hspa5 protein (rat)
Molecular Formula C₁₄₁H₂₂₆N₃₄O₅₁
Relative Molecular Mass 3213.54
CAS Registry Number [108563-23-1]
Source Synthetic
Storage Conditions -20 ± 5 °C
Areas of Interest Cancer Research