Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

Exendin (9-39) acetate salt
H-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH₂ acetate salt

H-8740

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-8740.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 285.00
CHF 265.05 (7%)
H-8740.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 490.00
CHF 455.70 (7%)
Add to Wish List
Add to Compare

Details

Exendin (9-39) is a potent glucagon-like peptide 1 (GLP-1) receptor antagonist. It has also been described as an antagonist of the putative exendin receptor. Exendin (9-39) blocks the stimulatory action of GLP-1 (7- 36) amide (H- 6795) and of exendin-4 (H- 8730) on cAMP production in pancreatic acini. Moreover, exendin (9-39) was shown to be safely used to abolish the incretin effect of GLP-1 without interfering with the control of insulin secretion by circulating nutrients.
Item Number 4017799
APC Number 46-3-10
One Letter Code DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH₂
Molecular Formula C₁₄₉H₂₃₄N₄₀O₄₇S
Relative Molecular Mass 3369.80
CAS Registry Number [133514-43-9] net
Source Synthetic
Storage Conditions -20 ± 5 °C
Keywords GLP-1 antagonist
Areas of Interest Diabetes