Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

Exendin-3 trifluoroacetate salt
H-His-Ser-Asp-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH₂ trifluoroacetate salt

H-8735

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-8735.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 285.00
CHF 265.05 (7%)
H-8735.1000 1 mg Ships within 3-5 business days  
CHF 490.00
CHF 455.70 (7%)
Add to Wish List
Add to Compare

Details

Exendin-3, a member of the glucagon superfamily, was originally isolated from the venom of the lizard, Heloderma horridum. At low concentrations, the 39-amino acid peptide interacts with putative exendin receptors causing an increase in pancreatic acinar cAMP, whereas at higher concentrations it interacts with VIP receptors to stimulate an increase in cellular cAMP and amylase release.
Item Number 4015051
APC Number 46-3-14
One Letter Code HSDGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH₂
Molecular Formula C₁₈₄H₂₈₂N₅₀O₆₁S
Relative Molecular Mass 4202.63
CAS Registry Number [130357-25-4] net
Source Synthetic
Storage Conditions -20 ± 5 °C
Areas of Interest Diabetes