Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

Exenatide acetate salt
H-His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH₂ acetate salt

H-8730

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-8730.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 285.00
CHF 265.05 (7%)
H-8730.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 490.00
CHF 455.70 (7%)
Add to Wish List
Add to Compare

Details

Exendin-4 (exenatide), originally isolated from Heloderma suspectum venom, differs from exendin-3 by only 2 N-terminal amino acid substitutions. This polypeptide causes an increase in acinar cAMP without stimulating amylase release. Exendin-4 and glucagon-like peptide 1 (7-36) amide bind with similar affinity to the glucagon-like peptide 1 receptor. Moreover, exendin-4 is also considered for clinical use in the treatment of type 2 diabetes.
Item Number 4019602
APC Number 46-3-12
One Letter Code HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH₂
Synonyms Exendin-4
Molecular Formula C₁₈₄H₂₈₂N₅₀O₆₀S
Relative Molecular Mass 4186.63
CAS Registry Number [141758-74-9] net
Source Synthetic
Storage Conditions -20 ± 5 °C
Keywords GLP-1 agonist

Bachem product citations