Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

Peptide YY (3-36) (human) trifluoroacetate salt
H-Ile-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Asn-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH₂ trifluoroacetate salt

H-8585

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-8585.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 206.00
CHF 191.58 (7%)
H-8585.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 361.00
CHF 335.73 (7%)
Add to Wish List
Add to Compare

Details

PYY (3-36), a Y2 receptor agonist, is released from the body's gastrointestinal tract in proportion to caloric intake. It has been shown that peripheral injection of PYY (3-36) in rats inhibited food intake and reduced weight gain. In addition, infusion of PYY (3-36) in humans significantly decreased appetite and reduced food intake by 33% over 24h, which suggests that PYY (3-36) has a role in 'longer term' regulation of food intake. Thus, the PYY (3-36) may represent a lead compound for the development of drugs for the treatment of obesity.
Item Number 4018880
APC Number 48-0-33
One Letter Code IKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH₂
Synonyms PYY (3-36) (human)
Molecular Formula C₁₈₀H₂₇₉N₅₃O₅₄
Relative Molecular Mass 4049.52
CAS Registry Number [123583-37-9] net
Source Synthetic
Storage Conditions -20 ± 5 °C