Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

PACAP-38 (human, mouse, ovine, porcine, rat) trifluoroacetate salt
H-His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH₂ trifluoroacetate salt

H-8430

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-8430.0200 0.2 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 163.00
CHF 151.59 (7%)
H-8430.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 361.00
CHF 335.73 (7%)
H-8430.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 649.00
CHF 603.57 (7%)
Add to Wish List
Add to Compare

Details

Kojro et al. observed that the PAC1 agonists PACAP-27 (H-1172) and PACAP-38 strongly increased the activity of α-secretase. Upregulation of this APP-degrading enzyme promotes the non-amyloidogenic processing of APP, i.e. reduces the production of Aβ40/42, and thus may help to prevent Alzheimer’s disease. Nasally applied PACAP-38 in APP[V717I]-transgenic mice additionally enhanced the production of the Aβ-degrading enzyme neprilysin via induction of somatostatin.
Item Number 4031157
APC Number 34-0-20
One Letter Code HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH₂
Synonyms Pituitary Adenylate Cyclase Activating Polypeptide-38 (human, mouse, ovine, porcine, rat), PACAP (1-38), human, ovine, rat
Molecular Formula C₂₀₃H₃₃₁N₆₃O₅₃S
Relative Molecular Mass 4534.32
CAS Registry Number [124123-15-5] net
Source Synthetic
Storage Conditions -20 ± 5 °C
Areas of Interest Alzheimer's Disease