Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page
New!

Availability: In stock

Amyloid β-Protein (42-1) (HFIP-treated)
H-Ala-Ile-Val-Val-Gly-Gly-Val-Met-Leu-Gly-Ile-Ile-Ala-Gly-Lys-Asn-Ser-Gly-Val-Asp-Glu-Ala-Phe-Phe-Val-Leu-Lys-Gln-His-His-Val-Glu-Tyr-Gly-Ser-Asp-His-Arg-Phe-Glu-Ala-Asp-OH (HFIP-treated)

H-8388

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-8388.0100 0.1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 120.00
CHF 111.60 (7%)
H-8388.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 395.00
CHF 367.35 (7%)
Add to Wish List
Add to Compare

Details

Reverse sequence of Aβ42, inactive control for the Aβ. Treating Aβ-peptides with 1,1,1,3,3,3-hexafluoroisopropanol (HFIP) is the standard method for disrupting amyloid fibrils and generating the Aβ monomers. Working with HFIP-treated Aβ-peptides has the advantage of getting more reproducible results whereas untreated Aβ-peptides may contain varying amounts and types of oligomeric structures.
Item Number 4107743
One Letter Code AIVVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD
Molecular Formula C₂₀₃H₃₁₁N₅₅O₆₀S
Relative Molecular Mass 4514.10
CAS Registry Number [317366-82-8] net
Source Synthetic
Storage Conditions -20 ± 5 °C
Areas of Interest Alzheimer's Disease