Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page
New!

Availability: In stock

BNP-32 (human) citrate salt
H-Ser-Pro-Lys-Met-Val-Gln-Gly-Ser-Gly-Cys-Phe-Gly-Arg-Lys-Met-Asp-Arg-Ile-Ser-Ser-Ser-Ser-Gly-Leu-Gly-Cys-Lys-Val-Leu-Arg-Arg-His-OH citrate salt
(Disulfide bond)

H-8354

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-8354.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 250.00
CHF 232.50 (7%)
H-8354.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 430.00
CHF 399.90 (7%)
Add to Wish List
Add to Compare

Details

The secretion of the cardiac hormone BNP-32 is increased considerably in patients with congestive heart failure, successful medical treatment of this condition will result in a decrease. Yandle et al. described a method for determining hBNP in human plasma. Effects of hBNP infusion in humans have been described by Holmes et al and La Villa et al. BNP is an important biomarker in the diagnosis of heart diseases. Additionally, BNP-32 may act as a neuropeptide.
BNP-32 exerts strong lipolytic effects in humans.
Item Number 4049848
One Letter Code SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH
Synonyms Nesiritide
Molecular Formula C₁₄₃H₂₄₄N₅₀O₄₂S₄
Relative Molecular Mass 3464.09
CAS Registry Number [124584-08-3] net
Source Synthetic
Storage Conditions -20 ± 5 °C
Keywords Biomarker for cardiac diseases; Lipolysis-inducing peptide