Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page
New!

Availability: In stock

Crotalicidin trifluoroacetate salt
H-Lys-Arg-Phe-Lys-Lys-Phe-Phe-Lys-Lys-Val-Lys-Lys-Ser-Val-Lys-Lys-Arg-Leu-Lys-Lys-Ile-Phe-Lys-Lys-Pro-Met-Val-Ile-Gly-Val-Thr-Ile-Pro-Phe-NH₂ trifluoroacetate salt

H-8328

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-8328.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 175.00
CHF 162.75 (7%)
H-8328.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 300.00
CHF 279.00 (7%)
Add to Wish List
Add to Compare

Details

Potent antimicrobial peptide with low cytotoxicity produced by the venom glands of Crotalus durissus terrificus.
Item Number 4105369
One Letter Code KRFKKFFKKVKKSVKKRLKKIFKKPMVIGVTIPF-NH₂
Molecular Formula C₂₀₃H₃₄₆N₅₄O₃₆S
Relative Molecular Mass 4151.39
CAS Registry Number [1818372-26-7] net
Source Synthetic
Storage Conditions -20 ± 5 °C