Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page
New!

Availability: In stock

Hispidalin trifluoroacetate salt
H-Ser-Asp-Tyr-Leu-Asn-Asn-Asn-Pro-Leu-Phe-Pro-Arg-Tyr-Asp-Ile-Gly-Asn-Val-Glu-Leu-Ser-Thr-Ala-Tyr-Arg-Ser-Phe-Ala-Asn-Gln-Lys-Ala-Pro-Gly-Arg-Leu-Asn-Gln-Asn-Trp-Ala-Leu-Thr-Ala-Asp-Tyr-Thr-Tyr-Arg-OH trifluoroacetate salt

H-8324

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-8324.0100 0.1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 115.00
CHF 106.95 (7%)
H-8324.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 395.00
CHF 367.35 (7%)
Add to Wish List
Add to Compare

Details

This bioactive peptide was purified from the seeds of the medicinal plant B. hispida. Referring to the published results of Sharma and coworkers, this novel peptide showed broad and potent inhibitory effects against various human bacterial and fungal pathogens; its growth inhibition was significantly comparable with commercial antibacterial and antifungal drugs.
Item Number 4105367
One Letter Code SDYLNNNPLFPRYDIGNVELSTAYRSFANQKAPGRLNQNWALTADYTYR
Molecular Formula C₂₅₅H₃₇₈N₇₂O₇₈
Relative Molecular Mass 5700.25
Source Synthetic
Storage Conditions -20 ± 5 °C