Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page
New!

Availability: In stock

Teplow's Peptide (1-42) trifluoroacetate salt
H-Tyr-His-Ala-Gly-Val-Asp-Lys-Glu-Val-Val-Phe-Asp-Glu-Gly-Ala-Gly-Ala-Glu-His-Gly-Leu-Ala-Gln-Lys-Ile-Val-Arg-Gly-Phe-Gly-Val-Ser-Asp-Val-Ser-Met-Ile-His-Ile-Asn-Leu-Phe-OH trifluoroacetate salt

H-8282

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-8282.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 330.00
CHF 306.90 (7%)
H-8282.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 495.00
CHF 460.35 (7%)
Add to Wish List
Add to Compare

Details

Specifically designed inactive control peptide for Abeta42.
Item Number 4104168
One Letter Code YHAGVDKEVVFDEGAGAEHGLAQKIVRGFGVSDVSMIHINLF
Molecular Formula C₂₀₃H₃₁₁N₅₅O₆₀S
Relative Molecular Mass 4514.10
Source Synthetic
Storage Conditions -20 ± 5 °C
Areas of Interest Alzheimer's Disease