Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page
New!

Availability: In stock

Teplow's Amyloid β-Protein (1-40) (scrambled II) trifluoroacetate salt
H-Tyr-His-Ala-Gly-Val-Asp-Lys-Glu-Val-Val-Phe-Asp-Glu-Gly-Gly-Ala-Glu-His-Gly-Leu-Ala-Gln-Lys-Ile-Val-Arg-Gly-Phe-Gly-Val-Ser-Asp-Val-Ser-Met-Ile-His-Asn-Leu-Phe-OH trifluoroacetate salt

H-8278

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-8278.0100 0.1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 95.00
CHF 88.35 (7%)
H-8278.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 330.00
CHF 306.90 (7%)
Add to Wish List
Add to Compare

Details

This peptide is a specifically designed negative control in studies with Abeta40. It is "scrambled", which means it contains the same amino acids as Abeta40, but in different order. Referring to studies by Yamin and coworkers, Teplow's Amyloid β-Protein (1-40) does not show a number of phenomena regularly observed with Abeta40 (fibril formation, oligomerization, toxicity to neurons) and furthermore has a relatively flat hydropathy profile, which can be an advantage in several studies, for example in order to avoid unspecific interaction with the cell membrane.
Item Number 4104167
One Letter Code YHAGVDKEVVFDEGGAEHGLAQKIVRGFGVSDVSMIHNLF
Synonyms β-Amyloid (1-40) (scrambled II), Aβ42 scrambled II
Molecular Formula C₁₉₄H₂₉₅N₅₃O₅₈S
Relative Molecular Mass 4329.86
Source Synthetic
Storage Conditions -20 ± 5 °C
Areas of Interest Alzheimer's Disease