Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page
New!

Availability: In stock

β-Defensin 2 (human) trifluoroacetate salt
H-Gly-Ile-Gly-Asp-Pro-Val-Thr-Cys-Leu-Lys-Ser-Gly-Ala-Ile-Cys-His-Pro-Val-Phe-Cys-Pro-Arg-Arg-Tyr-Lys-Gln-Ile-Gly-Thr-Cys-Gly-Leu-Pro-Gly-Thr-Lys-Cys-Cys-Lys-Lys-Pro-OH trifluoroacetate salt
(Disulfide bonds, air oxidized)

H-8256

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-8256.0100 0.1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 285.00
CHF 265.05 (7%)
H-8256.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 985.00
CHF 916.05 (7%)
Add to Wish List
Add to Compare

Details

Two β-defensins (hBD1 and hBD2) have been identified in humans. β-defensins are inducible, potent, and selectively killing mainly Gram-negative bacteria and yeast. In addition, β-defensins mobilize cells engaged in adaptive immune responses.
Item Number 4034693
One Letter Code GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP
Synonyms β-Defensin 4A (human), Skin-antimicrobial peptide 1 (human)
Molecular Formula C₁₈₈H₃₀₅N₅₅O₅₀S₆
Relative Molecular Mass 4328.23
Source Synthetic
Storage Conditions -20 ± 5 °C
Keywords Antimicrobial peptide