Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

Galanin (human) trifluoroacetate salt
H-Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Val-Gly-Asn-His-Arg-Ser-Phe-Ser-Asp-Lys-Asn-Gly-Leu-Thr-Ser-OH trifluoroacetate salt

H-8230

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-8230.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 309.00
CHF 287.37 (7%)
H-8230.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 567.00
CHF 527.31 (7%)
Add to Wish List
Add to Compare

Details

Human galanin, a 30-amino acid non-amidated peptide, has originally been isolated from colon and pituitary. Its sequence differs from that of rat and porcine galanins by 4 and 6 amino acids in the C-terminal moiety, respectively. Synthetic human galanin is equipotent to the rat peptide in the isolated rat fundus muscle strip bioassay. Both peptides also fully activate the rat galanin receptor, indicating the importance of the conserved N-terminal portion of galanin for receptor interaction.
Galanin, which is widely distributed in the CNS, and GAL receptors (GALR) are overexpressed in limbic brain regions associated with cognition in Alzheimer disease. As galanin inhibits acetylcholine release, galanin antagonists have gained interest in AD research.
Item Number 4013896
One Letter Code GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS
Molecular Formula C₁₃₉H₂₁₀N₄₂O₄₃
Relative Molecular Mass 3157.45
CAS Registry Number [119418-04-1] net
Source Synthetic
Storage Conditions -20 ± 5 °C
Areas of Interest Alzheimer's Disease