Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page
New!

Availability: In stock

Tide Fluor™ 5WS-Amyloid β-Protein (1-40) trifluoroacetate salt
Tide Fluor™ 5WS-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-OH trifluoroacetate salt

H-8202

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-8202.0100 0.1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 265.00
CHF 246.45 (7%)
H-8202.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 930.00
CHF 864.90 (7%)
Add to Wish List
Add to Compare

Details

Fluorescent dye-labeled Aβ40, excitation at 649 nm, emission at 664 nm. Tide Fluor™ 5WS shows strong fluorescence and excellent photostability.
Item Number 4101189
One Letter Code Tide Fluor™ 5WS-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Molecular Formula C₁₉₄H₂₉₅N₅₃O₅₈S + dye
Relative Molecular Mass 5062
Source Synthetic
Storage Conditions -20 ± 5 °C
Areas of Interest Alzheimer's Disease