Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page
New!

Availability: In stock

Tau Peptide (255-314) (Repeat 2 Domain) (human) trifluoroacetate salt
H-Asn-Val-Lys-Ser-Lys-Ile-Gly-Ser-Thr-Glu-Asn-Leu-Lys-His-Gln-Pro-Gly-Gly-Gly-Lys-Val-Gln-Ile-Ile-Asn-Lys-Lys-Leu-Asp-Leu-Ser-Asn-Val-Gln-Ser-Lys-Cys-Gly-Ser-Lys-Asp-Asn-Ile-Lys-His-Val-Pro-Gly-Gly-Gly-Ser-Val-Gln-Ile-Val-Tyr-Lys-Pro-Val-Asp-OH trifluoroacetate salt

H-8038

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-8038.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 585.00
CHF 544.05 (7%)
H-8038.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 995.00
CHF 925.35 (7%)
Add to Wish List
Add to Compare
Item Number 4088071
One Letter Code NVKSKIGSTENLKHQPGGGKVQIINKKLDLSNVQSKCGSKDNIKHVPGGGSVQIVYKPVD
Molecular Formula C₂₇₇H₄₆₇N₈₃O₈₆S
Relative Molecular Mass 6368.33
CAS Registry Number [2022995-68-0] net
Source Synthetic
Storage Conditions -20 ± 5 °C
Areas of Interest Tau Peptides