Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page
New!

Availability: In stock

Tau Peptide (245-274) (Repeat 1 Domain) trifluoroacetate salt
H-Thr-Ala-Pro-Val-Pro-Met-Pro-Asp-Leu-Lys-Asn-Val-Lys-Ser-Lys-Ile-Gly-Ser-Thr-Glu-Asn-Leu-Lys-His-Gln-Pro-Gly-Gly-Gly-Lys-OH trifluoroacetate salt

H-7978

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-7978.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 100.00
CHF 93.00 (7%)
H-7978.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 170.00
CHF 158.10 (7%)
Add to Wish List
Add to Compare
Item Number 4099396
One Letter Code TAPVPMPDLKNVKSKIGSTENLKHQPGGGK
Molecular Formula C₁₃₆H₂₃₀N₄₀O₄₂S
Relative Molecular Mass 3129.63
CAS Registry Number [1428134-39-7] net
Source Synthetic
Storage Conditions -20 ± 5 °C
Areas of Interest Tau Peptides