Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page
New!

Availability: In stock

Tyr-LL-37 trifluoroacetate salt
H-Tyr-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH trifluoroacetate salt

H-7902

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-7902.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 150.00
CHF 139.50 (7%)
H-7902.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 255.00
CHF 237.15 (7%)
Add to Wish List
Add to Compare

Details

LL-37 analog for radioiodination.
Item Number 4099712
One Letter Code YLLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES
Synonyms [Tyr133]- Cationic Antimicrobial Protein 18 (134-170) (human), Tyr- hCAP-18 (134-170)
Molecular Formula C₂₁₄H₃₄₉N₆₁O₅₅
Relative Molecular Mass 4656.50
CAS Registry Number [2022972-74-1] net
Source Synthetic
Storage Conditions -20 ± 5 °C