Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page
New!

Availability: In stock

LL-37 (37-1) trifluoroacetate salt
H-Ser-Glu-Thr-Arg-Pro-Val-Leu-Asn-Arg-Leu-Phe-Asp-Lys-Ile-Arg-Gln-Val-Ile-Arg-Lys-Phe-Glu-Lys-Gly-Ile-Lys-Glu-Lys-Ser-Lys-Arg-Phe-Phe-Asp-Gly-Leu-Leu-OH trifluoroacetate salt

H-7898

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-7898.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 170.00
CHF 158.10 (7%)
H-7898.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 290.00
CHF 269.70 (7%)
Add to Wish List
Add to Compare

Details

Reverse LL-37 used as control peptide.
Item Number 4099710
One Letter Code SETRPVLNRLFDKIRQVIRKFEKGIKEKSKRFFDGLL
Synonyms Cationic Antimicrobial Protein 18 (170-134) (human), hCAP-18 (170-134)
Molecular Formula C₂₀₅H₃₄₀N₆₀O₅₃
Relative Molecular Mass 4493.33
CAS Registry Number [2022972-70-7] net
Source Synthetic
Storage Conditions -20 ± 5 °C