Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page
New!

Availability: In stock

Biotinyl-εAhx-LL-37 (scrambled) trifluoroacetate salt
Biotinyl-εAhx-Gly-Leu-Lys-Leu-Arg-Phe-Glu-Phe-Ser-Lys-Ile-Lys-Gly-Glu-Phe-Leu-Lys-Thr-Pro-Glu-Val-Arg-Phe-Arg-Asp-Ile-Lys-Leu-Lys-Asp-Asn-Arg-Ile-Ser-Val-Gln-Arg-OH trifluoroacetate salt

H-7896

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-7896.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 360.00
CHF 334.80 (7%)
H-7896.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 610.00
CHF 567.30 (7%)
Add to Wish List
Add to Compare

Details

Biotin-LC-LL 37 (scrambled).
Item Number 4099709
One Letter Code Biotinyl-εAhx-GLKLRFEFSKIKGEFLKTPEVRFRDIKLKDNRISVQR
Synonyms Biotinyl-LC-Cationic Antimicrobial Protein 18 (134-170) (human) (Scrambled), Biotinyl-LC-hCAP-18 (134-170) (Scrambled)
Molecular Formula C₂₂₁H₃₆₅N₆₃O₅₆S
Relative Molecular Mass 4832.79
CAS Registry Number [2022972-72-9] net
Source Synthetic
Storage Conditions -20 ± 5 °C