Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page
New!

Availability: In stock

5-FAM-LL-37 (scrambled) trifluoroacetate salt
Fluorescein-5-carbonyl-Gly-Leu-Lys-Leu-Arg-Phe-Glu-Phe-Ser-Lys-Ile-Lys-Gly-Glu-Phe-Leu-Lys-Thr-Pro-Glu-Val-Arg-Phe-Arg-Asp-Ile-Lys-Leu-Lys-Asp-Asn-Arg-Ile-Ser-Val-Gln-Arg-OH trifluoroacetate salt

H-7888

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-7888.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 370.00
CHF 344.10 (7%)
H-7888.1000 1 mg Ships within 3-5 business days  
CHF 635.00
CHF 590.55 (7%)
Add to Wish List
Add to Compare
Item Number 4099708
One Letter Code 5-FAM-GLKLRFEFSKIKGEFLKTPEVRFRDIKLKDNRISVQR
Synonyms 5-FAM-hCAP-18 (134-170), Cationic Antimicrobial Protein 18 (134-170) 5-FAM labeled, (human)
Molecular Formula C₂₂₆H₃₅₀N₆₀O₅₉
Relative Molecular Mass 4851.63
CAS Registry Number [2022972-73-0] net
Source Synthetic
Storage Conditions -20 ± 5 °C