Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page
New!

Availability: In stock

LL-37 (scrambled) trifluoroacetate salt
H-Gly-Leu-Lys-Leu-Arg-Phe-Glu-Phe-Ser-Lys-Ile-Lys-Gly-Glu-Phe-Leu-Lys-Thr-Pro-Glu-Val-Arg-Phe-Arg-Asp-Ile-Lys-Leu-Lys-Asp-Asn-Arg-Ile-Ser-Val-Gln-Arg-OH trifluoroacetate salt

H-7886

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-7886.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 215.00
CHF 199.95 (7%)
H-7886.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 350.00
CHF 325.50 (7%)
Add to Wish List
Add to Compare

Details

Control peptide for LL37.
Item Number 4099707
One Letter Code GLKLRFEFSKIKGEFLKTPEVRFRDIKLKDNRISVQR
Synonyms Cationic Antimicrobial Protein 18 (134-170) (Scrambled) (human), hCAP-18 (134-170)
Molecular Formula C₂₀₅H₃₄₀N₆₀O₅₃
Relative Molecular Mass 4493.33
CAS Registry Number [1354065-56-7] net
Source Synthetic
Storage Conditions -20 ± 5 °C